PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0299s0130.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family NAC
Protein Properties Length: 353aa    MW: 38687.2 Da    PI: 9.3594
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0299s0130.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM171.42.8e-53151421128
                     NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatg 87 
                             lppGfrFhPtdeelvv+yLkkk+++ +l++ ++i+e+d+yk++Pw+Lp+k++ +e+ewyfFs+rd+ky++g r+nra++sgyWkatg
  SapurV1A.0299s0130.1.p  15 LPPGFRFHPTDEELVVHYLKKKAASVPLPV-TIIAEIDLYKFDPWELPRKATFGEQEWYFFSPRDRKYPNGARPNRAATSGYWKATG 100
                             79****************************.89***************988899********************************* PP

                     NAM  88 kdkevlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                             +dk++l++ + ++vg+kk Lvfy g+ pkg kt+W+mheyrl
  SapurV1A.0299s0130.1.p 101 TDKPILTAnGAQKVGVKKALVFYGGKPPKGIKTNWIMHEYRL 142
                             ******9856778***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.84E-647178IPR003441NAC domain
PROSITE profilePS5100561.78115178IPR003441NAC domain
PfamPF023654.7E-2816142IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 353 aa     Download sequence    Send to blast
MESTNSSSGS QHPQLPPGFR FHPTDEELVV HYLKKKAASV PLPVTIIAEI DLYKFDPWEL  60
PRKATFGEQE WYFFSPRDRK YPNGARPNRA ATSGYWKATG TDKPILTANG AQKVGVKKAL  120
VFYGGKPPKG IKTNWIMHEY RLINDNSSSK PPPPADTGNK KGGSLRLDDW VLCRIYKKNN  180
SQRPVDQGDK EDSMEGMFAT LQNSSHHNPE PPSASNHIAY ASLLVNEDTF FEGILSGDGM  240
QNGSISQLPS SSSKPNMSMT SVSTNTLPAA RTLPPHRYWN DSTGSPVGLA NSSGRRFHGE  300
LNAGISGTQE DSTSFVSMLN QLPQSTPSVH PSTLLDGVLR QPFQLSSLNW NS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A4e-761518117168NO APICAL MERISTEM PROTEIN
1ut4_B4e-761518117168NO APICAL MERISTEM PROTEIN
1ut7_A4e-761518117168NO APICAL MERISTEM PROTEIN
1ut7_B4e-761518117168NO APICAL MERISTEM PROTEIN
3swm_A4e-761518120171NAC domain-containing protein 19
3swm_B4e-761518120171NAC domain-containing protein 19
3swm_C4e-761518120171NAC domain-containing protein 19
3swm_D4e-761518120171NAC domain-containing protein 19
3swp_A4e-761518120171NAC domain-containing protein 19
3swp_B4e-761518120171NAC domain-containing protein 19
3swp_C4e-761518120171NAC domain-containing protein 19
3swp_D4e-761518120171NAC domain-containing protein 19
4dul_A4e-761518117168NAC domain-containing protein 19
4dul_B4e-761518117168NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00058PBMTransfer from AT1G61110Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC7753078e-81KC775307.1 Jatropha curcas NAC transcription factor 029 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002305677.10.0no apical meristem family protein
SwissprotQ8GY421e-113NAC25_ARATH; NAC transcription factor 25
TrEMBLB9H2550.0B9H255_POPTR; No apical meristem family protein
STRINGPOPTR_0004s03820.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16233498
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61110.11e-113NAC domain containing protein 25